HORDB

ID: hor006140
Uniprot ID: P23362
Protein name: Cholecystokinin-58 desnonopeptide
Gene name: CCK
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Family: Gastrin/cholecystokinin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0042755 eating behavior
GO CC: GO:0005576 extracellular region; GO:0030424 axon

Sequence: AVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISD
Length: 49
Propeptide: MNSGVSLCVLMAVLAAGALTQPVPPAEPAGSGLQRAEEAPRRQLRAVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Signal peptide: MNSGVSLCVLMAVLAAGALT
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006140_AF2.pdb

hor006140_ESM.pdb

Mass:	629755	Formula:	C231H389N79O71S
Absent amino acids:	CFW	Common amino acids:	AR
pI:	11.41	Basic residues:	10
Polar residues:	12	Hydrophobic residues:	16
Hydrophobicity:	-66.73	Boman Index:	-13371
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	89.8
Instability Index:	4072.45	Extinction Coefficient cystines:	1490
Absorbance 280nm:	31.04